NCOA62 (SNW1) Rabbit Polyclonal Antibody

CAT#: TA330234

Rabbit Polyclonal Anti-SKIIP Antibody

Product Images

WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateSNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

• 

  Human Intestine

• 

  Rabbit Anti-SKIIP antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: SNW domain containing 1
• Database Link:
  NP_036377
  Entrez Gene 22938 Human
  UniProt ID Q13573
• Background: SKIIP (Nuclear Protein SkiP, nuclear receptor coactivator NCoA-62, ski-interacting protein) is a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also interact with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.
• Synonyms: Bx42; NCOA-62; Prp45; PRPF45; SKIIP; SKIP
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Yeast: 83%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Notch signaling pathway, Spliceosome