Antibodies

Jump to Filters
View as table Download
ARA9 (AIP) Rabbit Polyclonal Antibody
TA339087

USD 310.00

5 Days

Rabbit Polyclonal Anti-AIP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF
ARA9 (AIP) Rabbit Polyclonal Antibody
TA350867

USD 345.00

In Stock

Rabbit Polyclonal Anti-AIP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human AIP