ARA9 (AIP) Rabbit Polyclonal Antibody

CAT#: TA339087

Rabbit Polyclonal Anti-AIP Antibody

Product Images

WB Suggested Anti-AIP Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AIP antibody: synthetic peptide directed towards the N terminal of human AIP. Synthetic peptide located within the following region: VAKSLRNIAVGKDPLEGQRHCCGVAQMREHSSLGHADLDALQQNPQPLIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: aryl hydrocarbon receptor interacting protein
• Database Link:
  NP_003968
  Entrez Gene 9049 Human
  UniProt ID O00170
• Background: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus. [provided by RefSeq, Sep 2008]
• Synonyms: ARA9; FKBP16; FKBP37; SMTPHN; XAP-2; XAP2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 90%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors