Antibodies

Jump to Filters
View as table Download
Asporin (ASPN) Rabbit Polyclonal Antibody
TA344139

USD 410.00

5 Days

Rabbit Polyclonal Anti-ASPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Asporin (ASPN) Rabbit Polyclonal Antibody
TA324854

USD 450.00

5 Days

Rabbit polyclonal ASPN Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human ASPN.