Antibodies

Jump to Filters
View as table Download
CLN6 Rabbit Polyclonal Antibody
TA315557

USD 345.00

In Stock

Rabbit polyclonal anti-CLN6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CLN6.
CLN6 Rabbit Polyclonal Antibody
AP01390PU-N

USD 370.00

2 Weeks

CLN6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
CLN6 Rabbit Polyclonal Antibody
TA342045

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLN6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the C terminal of human CLN6. Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA