Rabbit Polyclonal Anti-GNRH1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNRH1 |
Rabbit Polyclonal Anti-GNRH1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNRH1 |
GnRH (GNRH1) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
GNRH1 Antibody
Applications | IHC |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
GNRH1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNRH1 |