Antibodies

Jump to Filters
View as table Download
Kcnj1 Rabbit Polyclonal Antibody
TA328922

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Kir1.1

Applications IHC, WB
Reactivities Mouse, Rat
Immunogen GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1, (MW: 33 kDa). Intracellular, C-terminus.
KCNJ1 Rabbit Polyclonal Antibody
TA377714

USD 220.00

3 Weeks

KCNJ1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 182-391 of human KCNJ1 (NP_000211.1).
Modifications Unmodified