Mouse Monoclonal MBP Antibody (2H9)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TA336919 is a replacement of AM06698SU-N.
Mouse Monoclonal MBP Antibody (2H9)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MBP Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MBP Antibody: synthetic peptide directed towards the middle region of human MBP. Synthetic peptide located within the following region: FGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIV |
Myelin Basic Protein (MBP) chicken polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide KLH conjugated corresponding to a region of the MBP gene product shared between the Human (NP_002376) and Mouse (NP_034907) sequences. After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks, and then affinity-purified using a peptide column. |
Myelin Basic Protein / MBP Mouse Monoclonal (N-Terminus) (V/h5) Antibody
Applications | IHC |
Reactivities | Bovine, Guinea Pig, Human, Rabbit, Sheep |
Conjugation | Unconjugated |
Myelin Basic Protein (MBP) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of the human MBP |
MBP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MBP |
Rabbit Polyclonal Myelin Basic Protein Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 380.00
4 Weeks
Myelin Basic Protein (10D5) Mouse monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |