Antibodies

Jump to Filters
View as table Download
POFUT2 Rabbit Polyclonal Antibody
TA338933

USD 310.00

5 Days

Rabbit Polyclonal Anti-POFUT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POFUT2 antibody: synthetic peptide directed towards the C terminal of human POFUT2. Synthetic peptide located within the following region: RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP
POFUT2 (Center) Rabbit Polyclonal Antibody
AP53376PU-N

USD 450.00

2 Weeks

POFUT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 235-265 amino acids from the Central region of human POFUT2