Antibodies

Jump to Filters
View as table Download
GLUD1 Goat Polyclonal Antibody
TA316789

USD 425.00

In Stock

GLUD1 Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig
Conjugation Unconjugated
Immunogen GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%).
GLUD1 (+Glutamate dehydrogenase 2) Goat Polyclonal Antibody
AP23724PU-N

USD 375.00

5 Days

GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2.
GLUD1 Rabbit Polyclonal Antibody
TA316790

USD 425.00

In Stock

GLUD1 Rabbit anti-Bovine Polyclonal Antibody

Applications IHC
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase.
GLUD1 Rabbit Polyclonal Antibody
TA338163

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER
GLUD1 Rabbit Polyclonal Antibody
TA338162

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
GLUD1 Rabbit Polyclonal Antibody
TA368378

USD 380.00

4 Weeks

GLUD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLUD1
GLUD1 Rabbit Polyclonal Antibody
TA376611

USD 220.00

3 Weeks

GLUD1 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 54-240 of human GLUD1 (NP_005262.1).
Modifications Unmodified