Antibodies

Jump to Filters
View as table Download
Kv beta 2 (KCNAB2) Rabbit Polyclonal Antibody
TA331456

USD 375.00

5 Days

Rabbit polyclonal Anti-KCNAB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
Kcnab2 Mouse Monoclonal Antibody [Clone ID: K17/70]
73-021

USD 530.00

3 Weeks

Kcnab2 mouse monoclonal antibody, clone K17/70

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Kcnab2 Mouse Monoclonal Antibody [Clone ID: K17/70]
75-021

USD 530.00

3 Weeks

Kcnab2 mouse monoclonal antibody, clone K17/70

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Kcnab2 Rabbit Polyclonal Antibody
TA328972

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KVbeta2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide SPGMIYSTRYGSPKR(C), corresponding to amino acid residues 20-34 of rat KvÃ?2 . N-terminal part.
Kv beta 2 (KCNAB2) Rabbit Polyclonal Antibody
TA331457

USD 310.00

5 Days

Rabbit polyclonal Anti-KCNAB2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV