Antibodies

Jump to Filters
View as table Download
MAP4K4 Rabbit Polyclonal Antibody
TA330965

USD 375.00

5 Days

Rabbit polyclonal Anti-MAP4K4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
MAP4K4 Rabbit Polyclonal Antibody
TA378286

USD 220.00

3 Weeks

MAP4K4 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 480-650 of human MAP4K4 (NP_663719.2).
Modifications Unmodified