MAP4K4 Rabbit Polyclonal Antibody

CAT#: TA330965

Rabbit polyclonal Anti-MAP4K4 Antibody

Product Images

WB Suggested Anti-MAP4K4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Small Intestine

• 

  Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAP4K4 antibody: synthetic peptide directed towards the N terminal of human MAP4K4. Synthetic peptide located within the following region: PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 133 kDa
• Gene Name: mitogen-activated protein kinase kinase kinase kinase 4
• Database Link:
  NP_004825
  Entrez Gene 9448 Human
  UniProt ID O95819
• Background: MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: FLH21957; HEL-S-31; HGK; MEKKK4; NIK
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: MAPK signaling pathway