Rabbit Polyclonal Anti-PRDX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX1 antibody: synthetic peptide directed towards the N terminal of human PRDX1. Synthetic peptide located within the following region: SSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFV |
Peroxiredoxin 1 (PRDX1) (106-117) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Immunogen | Synthetic peptide from the internal region of the human protein sequence according to NP_859048.1 |
Anti-PRDX1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 103-115 amino acids of human peroxiredoxin 1 |
USD 380.00
4 Weeks
Germany
Japan
United Kingdom
China
