SP7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SP7 |
SP7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SP7 |
Rabbit Polyclonal anti-SP7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SP7 antibody: synthetic peptide directed towards the C terminal of human SP7. Synthetic peptide located within the following region: RTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSP |
Rabbit Polyclonal Anti-SP7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SP7 antibody: synthetic peptide directed towards the N terminal of human SP7. Synthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV |
SP7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SP7 |
SP7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SP7 |