SP7 Rabbit Polyclonal Antibody

CAT#: TA330207

Rabbit Polyclonal Anti-SP7 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SP7 antibody: synthetic peptide directed towards the N terminal of human SP7. Synthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 45 kDa
Gene Name Sp7 transcription factor
Background SP7 is a C2H2-type zinc finger transcription factor of the SP gene family and a putative master regulator of bone cell differentiation.
Synonyms OI11; OI12; osterix; OSX
Note Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Rat: 86%; Guinea pig: 86%
Reference Data
Protein Families ES Cell Differentiation/IPS, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.