Antibodies

Jump to Filters
View as table Download
Unrip (STRAP) Rabbit Polyclonal Antibody
TA346504

USD 410.00

5 Days

Rabbit Polyclonal Anti-STRAP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STRAP antibody: synthetic peptide directed towards the C terminal of human STRAP. Synthetic peptide located within the following region: ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL
Unrip (STRAP) Rabbit Polyclonal Antibody
TA350582

USD 345.00

In Stock

Rabbit Polyclonal Anti-STRAP Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
STRAP Rabbit Polyclonal Antibody
TA369445

USD 380.00

4 Weeks

STRAP rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human STRAP