Antibodies

Jump to Filters
View as table Download
TPTE Rabbit Polyclonal Antibody
TA341721

USD 310.00

5 Days

Rabbit Polyclonal Anti-TPTE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPTE antibody: synthetic peptide directed towards the C terminal of human TPTE. Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL