Antibodies

Jump to Filters
View as table Download
PHEMX (TSPAN32) Rabbit Polyclonal Antibody
TA339019

USD 310.00

5 Days

Rabbit Polyclonal Anti-TSPAN32 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSPAN32 antibody: synthetic peptide directed towards the middle region of human TSPAN32. Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR