Rabbit Polyclonal Anti-MDS032 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
Rabbit Polyclonal Anti-Use1 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Use1 antibody: synthetic peptide directed towards the N terminal of mouse 2010315L10RIK. Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS |
USE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
