Antibodies

Jump to Filters
View as table Download
ARF1 Rabbit Polyclonal Antibody
TA346559

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
G protein alpha S (GNAS) Rabbit Polyclonal Antibody
TA332753

USD 275.00

3 Weeks

Rabbit anti-GNAS Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GNAS
SHC (SHC1) Rabbit Polyclonal Antibody
AP20277PU-N

USD 370.00

2 Weeks

SHC (SHC1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat