Antibodies

View as table Download

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-HTR2C Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR2C

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-GRM5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRM5