Antibodies

Jump to Filters
View as table Download
PFKM Rabbit Polyclonal Antibody
TA308655

USD 415.00

5 Days

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)
TKTL2 Rabbit Polyclonal Antibody
TA346850

USD 410.00

5 Days

Rabbit Polyclonal Anti-TKTL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TKTL2 antibody: synthetic peptide directed towards the C terminal of human TKTL2. Synthetic peptide located within the following region: SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG