Antibodies

View as table Download

Rabbit Polyclonal antibody to PANK1 (pantothenate kinase 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 207 and 513 of PANK1 (Uniprot ID#Q8TE04)

Rabbit Polyclonal Anti-DPYS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPYS antibody: synthetic peptide directed towards the middle region of human DPYS. Synthetic peptide located within the following region: LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN

DPYD Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DPYD

Rabbit Polyclonal Anti-PANK4 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK4 antibody: synthetic peptide directed towards the middle region of human PANK4. Synthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD

Rabbit Polyclonal Anti-PANK4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK4 antibody: synthetic peptide directed towards the N terminal of human PANK4. Synthetic peptide located within the following region: MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Rabbit Polyclonal Anti-DPYS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPYS antibody: synthetic peptide directed towards the N terminal of human DPYS. Synthetic peptide located within the following region: VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1

Rabbit Polyclonal antibody to BCAT2 (branched chain aminotransferase 2, mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of BCAT2 (Uniprot ID#O15382)

Rabbit polyclonal antibody to DPYD (dihydropyrimidine dehydrogenase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 174 of (Uniprot ID#Q12882)

Goat Anti-ENPP1 / PC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KTHLPTFSQED, from the C Terminus of the protein sequence according to NP_006199.2.

Rabbit Polyclonal Anti-PANK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the middle region of HUMAN PANK2. Synthetic peptide located within the following region: FGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCAL

Rabbit Polyclonal Anti-PANK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the C-terminal region of Human PANK2. Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

BCAT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 88-115 amino acids from the Central region of human BCAT1

BCAT2 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 308-336 amino acids from the C-terminal region of human BCAT2

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG

Rabbit Polyclonal Anti-BCAT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT2

BCAT2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated