Antibodies

View as table Download

Rabbit Polyclonal CD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730]
CD4

USD 300.00

In Stock

Goat Polyclonal Anti-CD4 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli.

Rabbit Polyclonal Antibody against CD8A (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A.

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.

Rabbit Polyclonal Anti-CD8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A

Goat Polyclonal Anti-CD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1.

Rabbit Polyclonal CD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Antibody against CD8A (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A.

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4. Synthetic peptide located within the following region: PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4. Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA4