Antibodies

View as table Download

Goat Anti-GATA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1.

Rabbit Polyclonal GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3.

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Rabbit Polyclonal GATA3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA3

Rabbit Polyclonal GATA3 (Ser308) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GATA3 around the phosphorylation site of Serine 308
Modifications Phospho-specific

Rabbit Polyclonal Anti-GATA3 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the C terminal of human GATA3. Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Rabbit Polyclonal anti-GATA3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATA3 antibody: synthetic peptide directed towards the N terminal of human GATA3. Synthetic peptide located within the following region: MDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVC