Antibodies

View as table Download

ADRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADRB2

Rabbit polyclonal anti-ADRB2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRB2.

Rabbit Polyclonal Adrenergic Receptor beta2 (Ser346) Antibody (Phospho-specific)

Applications WB
Reactivities Human:S346
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2 around the phosphorylation site of Serine 346
Modifications Phospho-specific

Rabbit polyclonal anti-ADRB2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ADRB2.

Goat Polyclonal Antibody against ADRB2

Applications WB
Reactivities Human, Cow
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQGTVPSDNIDSQ, from the C Terminus of the protein sequence according to NP_000015.1.

Rabbit Polyclonal Adrenergic Receptor beta2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Adrenergic Receptor beta2

Rabbit Polyclonal Anti-ADRB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADRB2 antibody: synthetic peptide directed towards the middle region of human ADRB2. Synthetic peptide located within the following region: TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 21-33 amino acids of human adrenoceptor beta 2, surface

Anti-ADRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface

ADRB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 334-413 of human ADRB2 (NP_000015.1).
Modifications Unmodified