Antibodies

Jump to Filters
View as table Download
EPS8 Rabbit Polyclonal Antibody
TA307988

USD 415.00

5 Days

Rabbit polyclonal antibody to EPS8 (epidermal growth factor receptor pathway substrate 8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 761 and 822 of EPS8 (Uniprot ID#Q12929)
EPS8 Mouse Monoclonal Antibody [Clone ID: 18F1F2]
TA337153

USD 402.00

5 Days

Mouse Monoclonal Eps8 Antibody (18F1F2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
EPS8 Mouse Monoclonal Antibody [Clone ID: 18F5B11]
TA337160

USD 402.00

5 Days

Mouse Monoclonal Eps8 Antibody (18F5B11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
EPS8 Rabbit Polyclonal Antibody
TA335075

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPS8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPS8 antibody: synthetic peptide directed towards the middle region of human EPS8. Synthetic peptide located within the following region: VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH