Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-TGF beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta. |
TGFB1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TGFB1 |
TGFB1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TGFB1 |
Rabbit Polyclonal Anti-Tgfb1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV |
Carrier-free (BSA/glycerol-free) TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TGFB1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human TGFB1 |
TGFB1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-278 of human TGFB1 (NP_000651.3). |
| Modifications | Unmodified |
TGFB1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-278 of human TGFB1 (NP_000651.3). |
| Modifications | Unmodified |
TGFB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGFB1. |
TGFB1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-280 of human TGFB1 (NP_000651.3). |
| Modifications | Unmodified |
TGF beta 1 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TGFB1 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- TGFB1
Reactivities
- Mouse
Applications
- WB
Conjugates
- Unconjugated
Filter by
Antibody Hosts
Clonalities
Modifications
Families
Pathways
- Cell cycle (13)
- Chronic myeloid leukemia (13)
- Colorectal cancer (13)
- Cytokine-cytokine receptor interaction (13)
- Dilated cardiomyopathy (13)
- Hypertrophic cardiomyopathy (HCM) (13)
- MAPK signaling pathway (13)
- Pancreatic cancer (13)
- Pathways in cancer (13)
- Renal cell carcinoma (13)
- TGF-beta signaling pathway (13)