Rabbit Polyclonal Anti-BCAT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BCAT1 |
Rabbit Polyclonal Anti-BCAT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BCAT1 |
Rabbit Polyclonal Anti-BCAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG |
Carrier-free (BSA/glycerol-free) BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | Unconjugated |
BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | Biotin |
BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | HRP |
BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Dog |
Conjugation | Unconjugated |