Rabbit Polyclonal Anti-ESRRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN |
Goat Polyclonal Antibody against ESRRG
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRMSNKDRHIDS, from the internal region of the protein sequence according to NP_001429.2; NP_996317.1; NP_996318.1. |
Rabbit polyclonal ESRRG Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ESRRG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 189-221 amino acids from the Central region of human ESRRG. |
Rabbit Polyclonal Anti-ESRRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ESRRG antibody: synthetic peptide directed towards the N terminal of human ESRRG. Synthetic peptide located within the following region: TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRG mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) ESRRG mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
2 Days
USD 379.00
In Stock
ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ESRRG mouse monoclonal antibody,clone 1C2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
ESRRG mouse monoclonal antibody,clone 1C2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRG (Estrogen Related Receptor gamma) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ESRRG mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
ESRRG mouse monoclonal antibody,clone 5D7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
ESRRG mouse monoclonal antibody,clone 5D7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 159.00
2 Days
ESRRG mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
In Stock
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
2 Days
Germany
Japan
United Kingdom
China
