Antibodies

View as table Download

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA

Goat Polyclonal Antibody against SOCS1

Applications FC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VLRDYLSSFPFQI, from the C Terminus of the protein sequence according to NP_003736.1.

Rabbit anti-PIAS2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PIAS2

Rabbit Polyclonal SOCS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SOCS1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human SOCS1.

Rabbit Polyclonal Anti-PIAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS2 Antibody: A synthesized peptide derived from human PIAS2

Rabbit polyclonal anti-PIAS2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS2.

Rabbit Polyclonal PIAS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2.

Rabbit Polyclonal APC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human APC1.

Rabbit Polyclonal Anti-Pias2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE

Rabbit polyclonal APC1 phospho S355 antibody (Phospho-specific)

Applications WB
Reactivities Bovine, Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 351-359 of Human Apc1 protein.
Modifications Phospho-specific

Rabbit Polyclonal SOCS-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 54-68 (HFRTFRSHADYRRIT) of human SOCS1 was used as immunogen (NP_003736.1)

Rabbit anti SOCS1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-terminus of SOCS-1 protein from human and mouse origins.

Carrier-free (BSA/glycerol-free) PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PIAS2 mouse monoclonal antibody, clone OTI5B4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 200-211 amino acids of Human suppressor of cytokine signaling 1

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PIAS2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PIAS2 mouse monoclonal antibody,clone OTI5B4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PIAS2 mouse monoclonal antibody,clone OTI5B4

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-SOCS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOCS1

Rabbit polyclonal anti-SOCS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOCS1