PIAS2 Rabbit Polyclonal Antibody

CAT#: TA341797

Rabbit Polyclonal Anti-Pias2 Antibody

Product Images

WB Suggested Anti-Pias2 Antibody Titration: 0.2-1 ug/ml; Positive Control: NIH/3T3 cell lysate

• 

  Mouse Pancreas

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Pias2 antibody: synthetic peptide directed towards the C terminal of mouse Pias2. Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: protein inhibitor of activated STAT 2
• Database Link:
  NP_775298
  Entrez Gene 17344 MouseEntrez Gene 9063 Human
  UniProt ID O75928
• Background: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizingThe interaction between UBE2I andThe substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, includingThe STAT pathway,The p53 pathway andThe steroid hormone signaling pathway.The effects ofThis transcriptional coregulation, transactivation or silencing may vary depending uponThe biological context and PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing. Binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIASx-beta, but not isoform PIASx-alpha, promotes MDM2 sumoylation. Isoform PIASx-alpha promotes PARK7 sumoylation. Isoform PIASx-beta promotes NCOA2 sumoylation more efficiently than isoform PIASx-alpha (By similarity). Sumoylates PML at'Lys-65' and 'Lys-160'.
• Synonyms: ARIP3; DIP; MIZ; MIZ1; PIASX; PIASX-ALPHA; PIASX-BETA; SIZ2; ZMIZ4
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Mouse: 100%; Human: 93%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
• Protein Pathways: Jak-STAT signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis