Antibodies

Jump to Filters
View as table Download
Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA319010

USD 370.00

3 Weeks

Rabbit polyclonal anti-ACVR1C (ALK7) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 155 of mouse ALK-7
Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody
TA340402

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACVR1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP