Antibodies

View as table Download

Rabbit Polyclonal SCF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SCF antibody was raised against an 18 amino acid peptide from near the center of human SCF.

Rabbit Polyclonal Anti-SCF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.

Anti-Human SCF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF

Anti-Human SCF Goat Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human SCF

Anti-KITLG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF.

Rabbit Polyclonal Anti-KITLG Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG