Antibodies

View as table Download

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2.

BACE2 (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BACE2.

Rabbit Polyclonal Anti-BACE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF

Rabbit Polyclonal Anti-BACE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG

BACE2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-470 of human BACE2 (NP_036237.2).
Modifications Unmodified