BACE2 Rabbit Polyclonal Antibody

CAT#: TA341893

Rabbit Polyclonal Anti-BACE2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "BACE2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name beta-site APP-cleaving enzyme 2
Background This gene encodes an integral membrane glycoprotein that functions as an aspartic protease.The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step inThe etiology of Alzheimer's disease and Down syndrome.The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Synonyms AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 92%; Rabbit: 85%
Reference Data
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.