Antibodies

Jump to Filters
View as table Download
CX3CL1 Rabbit Polyclonal Antibody
TA319030

USD 355.00

3 Weeks

Rabbit polyclonal anti-CX3CL1 (Fractalkine) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human Fractalkine
CX3CL1 Rabbit Polyclonal Antibody
TA305991

USD 430.00

5 Days

Rabbit Polyclonal CX3CL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CX3CL1 antibody was raised against a peptide corresponding to 18 amino acids near the amino terminus of human CX3CL1 .
CX3CL1 Goat Polyclonal Antibody
TA329093

USD 375.00

5 Days

CX3CL1 / fractalkine (aa214-226) Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (KTSEAPSTQDPST)
CX3CL1 Rabbit Polyclonal Antibody
TA329183

USD 310.00

5 Days

Rabbit Polyclonal Anti-CX3CL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ