CX3CL1 Rabbit Polyclonal Antibody

CAT#: TA329183

Rabbit Polyclonal Anti-CX3CL1 Antibody

Product Images

Host: Rabbit; Target Name: CX3CL1; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 3.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CX3CL1 antibody is: synthetic peptide directed towards the middle region of Human CX3CL1. Synthetic peptide located within the following region: APHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: C-X3-C motif chemokine ligand 1
• Database Link:
  NP_002987
  Entrez Gene 6376 Human
  UniProt ID P78423
• Background: The function of this protein remains unknown.
• Synonyms: ABCD-3; C3Xkine; CXC3; CXC3C; fractalkine; neurotactin; NTN; NTT; SCYD1
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 85%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction