Rabbit Polyclonal Anti-Rngtt Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rngtt antibody is: synthetic peptide directed towards the N-terminal region of Rngtt. Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE |
Rabbit polyclonal antibody to HCE (RNA guanylyltransferase and 5'-phosphatase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 40 and 286 of HCE (Uniprot ID#O60942) |
RNGTT Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human RNGTT (NP_003791.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China