Germany
Japan
United Kingdom
China
Archaemetzincin 2 (AMZ2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide directed towards an internal region of rat AMZ2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-AMZ2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMZ2 Antibody: synthetic peptide directed towards the C terminal of human AMZ2. Synthetic peptide located within the following region: ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE |
Amz2 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Rat Amz2 |
AMZ2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 81-360 of human AMZ2 (NP_057711.3). |
| Modifications | Unmodified |