Archaemetzincin 2 (AMZ2) Rabbit Polyclonal Antibody

CAT#: TA336023

Rabbit Polyclonal Anti-AMZ2 Antibody

Product Images

WB Suggested Anti-AMZ2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: RPMI 8226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AMZ2 Antibody: synthetic peptide directed towards the C terminal of human AMZ2. Synthetic peptide located within the following region: ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: archaelysin family metallopeptidase 2
• Database Link:
  NP_001028746
  Entrez Gene 51321 Human
  UniProt ID Q86W34
• Background: The function of AMZ2 remains unknown.
• Synonyms: archaelysin family metallopeptidase 2; archaemetzincin-2; archaemetzincins-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome