DRIL1 (ARID3A) mouse monoclonal antibody, clone 1A11, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
DRIL1 (ARID3A) mouse monoclonal antibody, clone 1A11, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-ARID3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ARID3A Antibody: synthetic peptide directed towards the middle region of human ARID3A. Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG |
Rabbit Polyclonal Anti-ARID3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARID3A antibody: synthetic peptide directed towards the N terminal of human ARID3A. Synthetic peptide located within the following region: MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPPGRARAAPDEDREPE |
ARID3A Rabbit polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-593 of human ARID3A (NP_005215.1). |
Modifications | Unmodified |