CD209 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD209 |
CD209 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD209 |
Rabbit Polyclonal DC-SIGN Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-DIGN . |
Rabbit Polyclonal DC-SIGN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DC-SIGN antibody was raised against a synthetic peptide corresponding to amino acids near the center of human DC-SIGN . |
Mouse DC-SIGN Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse DC-SIGN Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CD209 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.389~393( E-Q-F-L-S )derived from Human CD209 (DC-SIGN). |
Rabbit Polyclonal anti-CD209 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD209 antibody: synthetic peptide directed towards the N terminal of human CD209. Synthetic peptide located within the following region: AGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQL |
Rabbit Polyclonal anti-CD209 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CD209 antibody is: synthetic peptide directed towards the C-terminal region of Human CD209. Synthetic peptide located within the following region: DCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
CD209 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 265-404 of human CD209 (NP_066978.1). |
Modifications | Unmodified |