Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-CD209 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.389~393( E-Q-F-L-S )derived from Human CD209 (DC-SIGN). |
Rabbit Polyclonal anti-CD209 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD209 antibody: synthetic peptide directed towards the N terminal of human CD209. Synthetic peptide located within the following region: AGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQL |
Rabbit Polyclonal anti-CD209 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CD209 antibody is: synthetic peptide directed towards the C-terminal region of Human CD209. Synthetic peptide located within the following region: DCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA |
CD209 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 265-404 of human CD209 (NP_066978.1). |
| Modifications | Unmodified |