Antibodies

View as table Download

CHFR rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CHFR

Rabbit Polyclonal Anti-CHFR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHFR antibody: synthetic peptide directed towards the N terminal of human CHFR. Synthetic peptide located within the following region: REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN

Rabbit polyclonal anti-CHFR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CHFR.

CHFR Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human CHFR (NP_001154818.1).
Modifications Unmodified