Rabbit Polyclonal CITED2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CITED2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CITED2. |
Rabbit Polyclonal CITED2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CITED2 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human CITED2. |
CITED2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 207-234 amino acids from the C-terminal region of human CITED2 |
Rabbit polyclonal anti-CITED2 antibody (NT)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CITED2 antibody was raised against an 18 amino acid peptide near the amino terminus of human CITED2. |
Rabbit Polyclonal Anti-CITED2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: HIHYGAGNMNATSGIRHAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVA |
Rabbit Polyclonal Anti-CITED2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CITED2 antibody: synthetic peptide directed towards the N terminal of human CITED2. Synthetic peptide located within the following region: ADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNAL |
CITED2 Antibody - middle region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse CITED2 |
CITED2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-275 of human CITED2 (NP_001161861.2). |
Modifications | Unmodified |