Antibodies

View as table Download

Rabbit Polyclonal CAD Antibody

Applications IF, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen CAD antibody was raised against a peptide corresponding to amino acids 314 to 329 of murine CAD .

Rabbit Polyclonal CAD Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen CAD antibody was raised against a peptide corresponding to 17 amino acids near the center of murine CAD .

DFFB (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human DFFB / CAD.

Rabbit Polyclonal DFF40 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DFF40 antibody was raised against a peptide corresponding to 18 amino acids near the center of murine CAD. The immunogen is located within amino acids 130 - 180 of DFF40.

Rabbit Polyclonal DFF40 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DFF40 antibody was raised against a peptide corresponding to amino acids 3 to 18 of human DFF40.

Rabbit Polyclonal DFF40 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DFF40 antibody was raised against a peptide corresponding to amino acids 203 to 218 of human DFF40 .

Rabbit Polyclonal Anti-DFFB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK

DFFB Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human DFFB

DFFB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 109-338 of human DFFB (NP_004393.1).
Modifications Unmodified