Rabbit Polyclonal Anti-IFIT3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IFIT3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IFIT3. |
Rabbit Polyclonal Anti-IFIT3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IFIT3 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IFIT3. |
Rabbit polyclonal antibody to IFIT3 (interferon-induced protein with tetratricopeptide repeats 3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 230 and 490 of IFIT3 (Uniprot ID#O14879) |
Rabbit Polyclonal Anti-IFIT3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFIT3 antibody: synthetic peptide directed towards the N terminal of human IFIT3. Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY |
Carrier-free (BSA/glycerol-free) IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIT3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human IFIT3 |
IFIT3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFIT3 |
IFIT3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 291-490 of human IFIT3 (NP_001540.2). |
Modifications | Unmodified |
IFIT3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of mouse IFIT3 |
Modifications | Unmodified |
IFIT3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-331 of mouse IFIT3 (NP_034631.1). |
Modifications | Unmodified |
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-IFIT3 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |