IFIT3 Rabbit Polyclonal Antibody

CAT#: TA338978

Rabbit Polyclonal Anti-IFIT3 Antibody

Product Images

WB Suggested Anti-IFIT3 Antibody Titration: 0.25 ug/ml; Positive Control: HepG2 cell lysate

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFIT3 antibody: synthetic peptide directed towards the N terminal of human IFIT3. Synthetic peptide located within the following region: ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: interferon induced protein with tetratricopeptide repeats 3
• Database Link:
  NP_001026853
  Entrez Gene 3437 Human
  UniProt ID O14879
• Background: The function remains unknown.
• Synonyms: CIG-49; GARG-49; IFI60; IFIT4; IRG2; ISG60; P60; RIG-G
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Bovine: 86%; Mouse: 79%