NFS1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 120-149aa) of human NFS1 |
NFS1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 120-149aa) of human NFS1 |
Rabbit Polyclonal Anti-NFS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NFS1 Antibody: synthetic peptide directed towards the middle region of human NFS1. Synthetic peptide located within the following region: TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV |
Carrier-free (BSA/glycerol-free) NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NFS1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NFS1 |
NFS1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 208-457 of human NFS1 (NP_066923.3). |
Modifications | Unmodified |
NFS1 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 208-457 of human NFS1 (NP_066923.3). |
Modifications | Unmodified |
NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NFS1 mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NFS1 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |